DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and Sox6

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_038962229.1 Gene:Sox6 / 293165 RGDID:1309000 Length:855 Species:Rattus norvegicus


Alignment Length:278 Identity:67/278 - (24%)
Similarity:110/278 - (39%) Gaps:87/278 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSSSSNCSKDRAKPVETLVLANYALKAEQKKAQGQGGRKEDERITTAVM-----------KVL 54
            |:....|||..::.:           .:.|....|..|...||.::...|:           |.:
  Rat   556 MNSMGLSNCRNEKER-----------TRFENLGPQLTGKSSEDGKLGPGVIDLTRPEDAEGSKAM 609

  Fly    55 EG--------YDW---NLVQASAKAPTDRK-----KEHIKRPMNAFMVWAQAARRVMSKQYPHLQ 103
            .|        |.|   ....|.|:...|.:     :.|||||||||||||:..||.:.:.:|.:.
  Rat   610 NGSAAKLQQYYCWPTGGATVAEARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMH 674

  Fly   104 NSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQ-------- 160
            ||.:||.||..||::.:.:|:|:.|...:|...|.:::|:|||:||.|:..::..::        
  Rat   675 NSNISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIVDGKKLRIGEYKQ 739

  Fly   161 ------------------------SGEG-----------GSPGPEMTLSATMGSSGKPRSS---- 186
                                    :|.|           .:|.|:|| |....:|..|..|    
  Rat   740 LMRSRRQEMRQFFTVGQQPQIPITTGTGVVYPGAITMATTTPSPQMT-SDCSSTSASPEPSLPVI 803

  Fly   187 -NSNGQRRAGKGNAAADL 203
             ::.|.:..|...|..|:
  Rat   804 QSTYGMKMDGASLAGNDM 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 31/69 (45%)
Sox6XP_038962229.1 SOX-TCF_HMG-box 647..718 CDD:238684 32/70 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.