DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and matmc_1

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_595875.1 Gene:matmc_1 / 2540048 PomBaseID:SPBC1711.02 Length:181 Species:Schizosaccharomyces pombe


Alignment Length:80 Identity:25/80 - (31%)
Similarity:47/80 - (58%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 EHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQ 139
            |...||.|||:::.:.....:.|..|.:.||::||.:|::|:|.....:..:.:.:|..:..|::
pombe   101 ERTPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRNESKEVRMRYFKMSEFYKAQHQK 165

  Fly   140 EHPDYKYQPRRKKAR 154
            .:|.||||||:.|.:
pombe   166 MYPGYKYQPRKNKVK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 18/69 (26%)
matmc_1NP_595875.1 MATA_HMG-box 102..178 CDD:238685 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm47165
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.