DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and Sry

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_036904.1 Gene:Sry / 25221 RGDID:3759 Length:169 Species:Rattus norvegicus


Alignment Length:86 Identity:43/86 - (50%)
Similarity:66/86 - (76%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQE 140
            |:||||||||||::..||.:::|.|.:||||:||.||..||:|.:::|:||.:.|::|:..|:::
  Rat     4 HVKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKHLGYQWKSLTEAEKRPFFQEAQRLKTLHREK 68

  Fly   141 HPDYKYQPRRKKARVLPSQQS 161
            :|:|||||.|   ||...|:|
  Rat    69 YPNYKYQPHR---RVKVPQRS 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 34/69 (49%)
SryNP_036904.1 Sufficient for interaction with KPNB1. /evidence=ECO:0000250|UniProtKB:Q05066 4..81 40/79 (51%)
SOX-TCF_HMG-box 4..74 CDD:238684 34/69 (49%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 6..22 11/15 (73%)
Sufficient for interaction with EP300. /evidence=ECO:0000250|UniProtKB:Q05066 52..84 14/34 (41%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 75..81 4/8 (50%)
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000250|UniProtKB:Q05738 92..144
Necessary for interaction with SLC9A3R2 and nuclear accumulation of SLC9A3R2. /evidence=ECO:0000250|UniProtKB:Q05738 94..138
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..169
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342375
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.