Sequence 1: | NP_651839.1 | Gene: | Sox100B / 45039 | FlyBaseID: | FBgn0024288 | Length: | 529 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006506994.1 | Gene: | Sox5 / 20678 | MGIID: | 98367 | Length: | 792 | Species: | Mus musculus |
Alignment Length: | 262 | Identity: | 65/262 - (24%) |
---|---|---|---|
Similarity: | 103/262 - (39%) | Gaps: | 94/262 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 SNCSKDRAKPVETLVLANYALKAEQKKAQGQGGRKEDERITTAVMKVLEGYDWNL---VQASAKA 68
Fly 69 PTDR----------KKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDK 123
Fly 124 KPFMEFAEKLRMTHKQEHPDYKYQPR--------RKKARV------------------------- 155
Fly 156 -----------------------LPSQQSGEGGSPGPEM-TLSATMGSSGKP-------RSSNSN 189
Fly 190 GQ 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox100B | NP_651839.1 | SOX-TCF_HMG-box | 76..146 | CDD:238684 | 32/69 (46%) |
Sox5 | XP_006506994.1 | SOX-TCF_HMG-box | 584..655 | CDD:238684 | 33/70 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |