DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and Sox3

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_033263.2 Gene:Sox3 / 20675 MGIID:98365 Length:450 Species:Mus musculus


Alignment Length:319 Identity:94/319 - (29%)
Similarity:134/319 - (42%) Gaps:88/319 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHK 138
            ::.:||||||||||::..||.|:.:.|.:.|||:||.||..||.|.|::|:||::.|::||..|.
Mouse   141 QDRVKRPMNAFMVWSRGQRRKMALENPKMHNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAVHM 205

  Fly   139 QEHPDYKYQPRRKKARVLPSQQ-SGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAAD 202
            :|:|||||:||||...:|...: |..||...|....:|...::             |...::...
Mouse   206 KEYPDYKYRPRRKTKTLLKKDKYSLPGGLLPPGAAAAAAAAAA-------------AAAASSPVG 257

  Fly   203 LGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSS-LTPP 266
            :|....|.:|.|..:|.                 |.||:::.|   |...|    .|||| ..||
Mouse   258 VGQRLDTYTHVNGWANG-----------------AYSLVQEQL---GYAQP----PSMSSPPPPP 298

  Fly   267 ATP----YNVA---------PS-----NAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREY 313
            |.|    |::|         |.     ||.|:||                |..|||.:..:....
Mouse   299 ALPQMHRYDMAGLQYSPMMPPGAQSYMNAAAAAA----------------AASGYGGMAPSAAAA 347

  Fly   314 VAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRV-SYPAYSYPANGGH 371
            .|..    .||.....:.|....|...:          |..||.| |.|:...||...|
Mouse   348 AAAA----YGQQPATAAAAAAAAAAMSL----------GPMGSVVKSEPSSPPPAIASH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 36/69 (52%)
Sox3NP_033263.2 SOX-TCF_HMG-box 143..214 CDD:238684 37/70 (53%)
SOXp 213..306 CDD:289133 31/129 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.