DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and Sox13

DIOPT Version :10

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_011246247.1 Gene:Sox13 / 20668 MGIID:98361 Length:621 Species:Mus musculus


Alignment Length:89 Identity:39/89 - (43%)
Similarity:60/89 - (67%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMT 136
            |...|||||||||||||:..||.:.:.:|.:.||.:||.||..||::.:.:|:|:.|...:|...
Mouse   419 RNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMTNQEKQPYYEEQARLSRQ 483

  Fly   137 HKQEHPDYKYQPRRKKARVLPSQQ 160
            |.:::|||||:||.|:..|:..::
Mouse   484 HLEKYPDYKYKPRPKRTCVVEGRR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 35/73 (48%)
Sox13XP_011246247.1 HMG-box_SoxD 423..499 CDD:438839 36/75 (48%)

Return to query results.
Submit another query.