DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox-4

DIOPT Version :10

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001335567.1 Gene:sox-4 / 182547 WormBaseID:WBGene00015716 Length:260 Species:Caenorhabditis elegans


Alignment Length:107 Identity:47/107 - (43%)
Similarity:66/107 - (61%) Gaps:1/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKK 124
            |..|.||..|...::..|||||||||||:|..|:.::.......||::||.||..|:.:::.:|.
 Worm   104 NSSQKSASQPRTAREPRIKRPMNAFMVWSQQRRQQIAATGQKFHNSDISKMLGAEWRKMEEHEKV 168

  Fly   125 PFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGS 166
            ||:|.|::||..|...||||.|:|||:| ||..|..|.:..|
 Worm   169 PFVERAKQLREEHFNAHPDYVYRPRRRK-RVEKSAGSVDSNS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 34/73 (47%)
sox-4NP_001335567.1 HMG-box_SOX 120..194 CDD:438820 34/73 (47%)

Return to query results.
Submit another query.