DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox-4

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001335567.1 Gene:sox-4 / 182547 WormBaseID:WBGene00015716 Length:260 Species:Caenorhabditis elegans


Alignment Length:107 Identity:47/107 - (43%)
Similarity:66/107 - (61%) Gaps:1/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKK 124
            |..|.||..|...::..|||||||||||:|..|:.::.......||::||.||..|:.:::.:|.
 Worm   104 NSSQKSASQPRTAREPRIKRPMNAFMVWSQQRRQQIAATGQKFHNSDISKMLGAEWRKMEEHEKV 168

  Fly   125 PFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGGS 166
            ||:|.|::||..|...||||.|:|||:| ||..|..|.:..|
 Worm   169 PFVERAKQLREEHFNAHPDYVYRPRRRK-RVEKSAGSVDSNS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 32/69 (46%)
sox-4NP_001335567.1 SOX-TCF_HMG-box 120..191 CDD:238684 32/70 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_142168
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.