DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox-2

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_741836.1 Gene:sox-2 / 181002 WormBaseID:WBGene00004949 Length:283 Species:Caenorhabditis elegans


Alignment Length:134 Identity:49/134 - (36%)
Similarity:73/134 - (54%) Gaps:36/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GQGGRKEDERITTAVMKVLEGYDWNLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYP 100
            |:.|:|.|:|                               :||||||||||::..|:.|:.:.|
 Worm    50 GKDGKKNDDR-------------------------------VKRPMNAFMVWSRGQRKKMALENP 83

  Fly   101 HLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGG 165
            .:.|||:||.||..||.|.:.:|:||::.|::||..|.:|||||||:||||...:     :.:.|
 Worm    84 KMHNSEISKRLGTEWKMLSEQEKRPFIDEAKRLRAIHMKEHPDYKYRPRRKTKSI-----NKKNG 143

  Fly   166 SPGP 169
            :|.|
 Worm   144 APIP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 35/69 (51%)
sox-2NP_741836.1 SOX-TCF_HMG-box 59..130 CDD:238684 37/101 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.