DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox-2

DIOPT Version :10

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_741836.1 Gene:sox-2 / 181002 WormBaseID:WBGene00004949 Length:283 Species:Caenorhabditis elegans


Alignment Length:134 Identity:49/134 - (36%)
Similarity:73/134 - (54%) Gaps:36/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GQGGRKEDERITTAVMKVLEGYDWNLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQYP 100
            |:.|:|.|:|                               :||||||||||::..|:.|:.:.|
 Worm    50 GKDGKKNDDR-------------------------------VKRPMNAFMVWSRGQRKKMALENP 83

  Fly   101 HLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKKARVLPSQQSGEGG 165
            .:.|||:||.||..||.|.:.:|:||::.|::||..|.:|||||||:||||...:     :.:.|
 Worm    84 KMHNSEISKRLGTEWKMLSEQEKRPFIDEAKRLRAIHMKEHPDYKYRPRRKTKSI-----NKKNG 143

  Fly   166 SPGP 169
            :|.|
 Worm   144 APIP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 38/73 (52%)
sox-2NP_741836.1 HMG-box_SoxB 58..137 CDD:438790 42/109 (39%)

Return to query results.
Submit another query.