DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and Sox5

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_006237666.1 Gene:Sox5 / 140587 RGDID:620471 Length:764 Species:Rattus norvegicus


Alignment Length:262 Identity:65/262 - (24%)
Similarity:102/262 - (38%) Gaps:94/262 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNCSKDRAKPVETLVLANYALKAEQKKAQGQGGRKEDERITTAVMKVLEGYDWNL---VQASAKA 68
            |||..::.|.....:....|:|           :.|:.:.:..:|      |:|:   ...||..
  Rat   491 SNCRTEKEKTTLESLTQQLAVK-----------QNEEGKFSHGMM------DFNMSGDSDGSAGV 538

  Fly    69 PTDR----------KKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDK 123
            ...|          .:.|||||||||||||:..||.:.:.:|.:.||.:||.||..||.:.:.:|
  Rat   539 SESRIYRESRGRGSNEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLEK 603

  Fly   124 KPFMEFAEKLRMTHKQEHPDYKYQPR--------RKKARV------------------------- 155
            :|:.|...:|...|.:::|||||:||        .||.|:                         
  Rat   604 QPYYEEQARLSKQHLEKYPDYKYKPRPKRTCLVDGKKLRIGEYKAIMRNRRQEMRQYFNVGQQAQ 668

  Fly   156 -----------------------LPSQQSGEGGSPGPEM-TLSATMGSSGKP-------RSSNSN 189
                                   |||:.|....||.|.| .:.:|.|..|:.       ::.:.|
  Rat   669 IPIATAGVVYPGAIAMAGMPSPHLPSEHSSVSSSPEPGMPVIQSTYGVKGEEPHIKEEIQAEDIN 733

  Fly   190 GQ 191
            |:
  Rat   734 GE 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 32/69 (46%)
Sox5XP_006237666.1 SOX-TCF_HMG-box 556..627 CDD:238684 33/70 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.