DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox32

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_571926.1 Gene:sox32 / 116990 ZFINID:ZDB-GENE-011026-1 Length:307 Species:Danio rerio


Alignment Length:231 Identity:72/231 - (31%)
Similarity:118/231 - (51%) Gaps:33/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KEDERITTA-------VMKVLEGYDWNLVQASAKAPTDRKKEHIKRPMNAFMVWAQAARRVMSKQ 98
            :.||:..||       :..|..|.:.:.....||||.:.:   ::||:|||::|.:..||.:::.
Zfish    30 QNDEQRRTAHCPASGPLSPVSVGSESSCSSPEAKAPVETR---VRRPLNAFIIWTKEERRRLAQL 91

  Fly    99 YPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRR----KKARVLPSQ 159
            .|.|:|::|||.|||.||.:..:||:|:|:.||:||:.|..::|:|||:|||    |::..:||.
Zfish    92 NPDLENTDLSKILGKTWKAMSLADKRPYMQEAERLRIQHTIDYPNYKYRPRRRKCNKRSSKMPSS 156

  Fly   160 QSGEGGSPGPEMTLSATMGSSGKPRSSNS-NGQRRAGKGNAAADLGSCASTISHANVGSNSSDVF 223
            ::  ..||.....||.........|..|. |..|....|.:..:    .|:..|....|:|.:||
Zfish   157 EN--VSSPNATFDLSYMFQGQAPQRPYNQINSYRLPHNGFSFEN----HSSSYHFEATSSSGNVF 215

  Fly   224 SNEAFMKSLN------SACAASLM------EQSLIE 247
            ...|...:|:      ||.:.||:      :||.:|
Zfish   216 HGGATSMNLSNVHLPRSAYSESLLYSQHSVQQSAVE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 30/69 (43%)
sox32NP_571926.1 SOX-TCF_HMG-box 69..140 CDD:238684 31/73 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582329
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.