DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and SOX30

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_848511.1 Gene:SOX30 / 11063 HGNCID:30635 Length:753 Species:Homo sapiens


Alignment Length:435 Identity:105/435 - (24%)
Similarity:159/435 - (36%) Gaps:118/435 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQE 140
            |:|||||||||||:..|..::|..|...|:|:|..||..|..|.:..|||:.:.|:|::..|::|
Human   336 HVKRPMNAFMVWARIHRPALAKANPAANNAEISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREE 400

  Fly   141 HPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGS 205
            .|.:.||||..|.:..|               ||.:...||..::.                   
Human   401 FPGWVYQPRPGKRKRFP---------------LSVSNVFSGTTQNI------------------- 431

  Fly   206 CASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTP-PATP 269
                     :.:|.:.|:   .:.....|....||........|..||.....:.:..:| |.|.
Human   432 ---------ISTNPTTVY---PYRSPTYSVVIPSLQNPITHPVGETSPAIQLPTPAVQSPSPVTL 484

  Fly   270 YNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVNYQG--QSAGVQSGA 332
            :..:.|:|...|..:|||       ||                |.|:....:.|  |:...|..:
Human   485 FQPSVSSAAQVAVQDPSL-------PV----------------YPALPPQRFTGPSQTDTHQLHS 526

  Fly   333 EGGGAGQEMD--FLENINGYGGYTGSRVSYPAYSYPANGGHFATEEQQQQQALQASEALNYKPAA 395
            |.....::..  .||:.|        |:|..|.:..|   .|||...|..:..   .:::..|.:
Human   527 EATHTVKQPTPVSLESAN--------RISSSASTAHA---RFATSTIQPPREY---SSVSPCPRS 577

  Fly   396 ADIDPKEIDQYFMDQMLPMTQHHHPHHTHPLHHPLHHSPPLNSSASLSSACSSASSQQPVAEYYE 460
            |.|          .|..|:.   |||        ::..|||...|:|.......|...|......
Human   578 API----------PQASPIP---HPH--------VYQPPPLGHPATLFGTPPRFSFHHPYFLPGP 621

  Fly   461 HLGYSPAASSASQNPNFGPQQPYANGAASMTPTLG---DPAPQQE 502
            |  |.|:::.....|.||    |.|..:||...|.   |..|:.|
Human   622 H--YFPSSTCPYSRPPFG----YGNFPSSMPECLSYYEDRYPKHE 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 30/69 (43%)
SOX30NP_848511.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..161
SOX-TCF_HMG-box 336..406 CDD:238684 30/69 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 514..575 15/74 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 726..753
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.