DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and LOC103910042

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_009296780.2 Gene:LOC103910042 / 103910042 -ID:- Length:221 Species:Danio rerio


Alignment Length:221 Identity:78/221 - (35%)
Similarity:110/221 - (49%) Gaps:25/221 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 EHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQ 139
            |||||||||||||::..||.|:.:.|.:.|||:||.||..||.|.||:|:|:::.|::||..|.:
Zfish    12 EHIKRPMNAFMVWSRGQRRQMALENPKMHNSEISKRLGAEWKRLSDSEKRPYIDEAKRLRAQHMR 76

  Fly   140 EHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATM---GSSGKPRSSNSNGQRRAGKGNAAA 201
            |||||||:||||...:|..           :|.||..:   ..|.|||..:|:.  .|.:.....
Zfish    77 EHPDYKYRPRRKPKGLLRK-----------DMVLSLPLVGQSDSEKPRDVHSSS--AAAQHQFVE 128

  Fly   202 DLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASL--------MEQSLIETGLDSPCSTAS 258
            ...|..:...|..:|.::..:..:.|.........|.||        ...|....|...|||.:.
Zfish   129 QSRSTCTVFPHEKLGFSTGSLAFSPALGYQGGHRSAGSLGCPGQFAHTHLSPANPGYLLPCSCSH 193

  Fly   259 SMSSLTPPATPYNVAPSNAKASAANN 284
            ..:||:||...|.|.|..:. ||.|:
Zfish   194 WSASLSPPPLAYIVFPGMSN-SAINS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 39/69 (57%)
LOC103910042XP_009296780.2 SOX-TCF_HMG-box 13..84 CDD:238684 40/70 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.