DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and HMG20A

DIOPT Version :10

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_060670.1 Gene:HMG20A / 10363 HGNCID:5001 Length:347 Species:Homo sapiens


Alignment Length:161 Identity:33/161 - (20%)
Similarity:66/161 - (40%) Gaps:10/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSSSNCSKDRAKPVETLVLANYALKAEQKKAQGQGGRKEDERITTAVMKVLEGYDWNLVQASAKA 68
            ||.:..|.:..:.||.|.............|:|...|.|||:      :...| .|:..:...|.
Human    39 SSGATSSTNNPEFVEDLSQGQLLQSESSNAAEGNEQRHEDEQ------RSKRG-GWSKGRKRKKP 96

  Fly    69 PTDRKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKL 133
            ..|....  |.|:..::.:....|..:..:.|.:...|:::.||..|..|...:|:.:::.|::.
Human    97 LRDSNAP--KSPLTGYVRFMNERREQLRAKRPEVPFPEITRMLGNEWSKLPPEEKQRYLDEADRD 159

  Fly   134 RMTHKQEHPDY-KYQPRRKKARVLPSQQSGE 163
            :..:.:|...| |.:..:..:|....:|.|:
Human   160 KERYMKELEQYQKTEAYKVFSRKTQDRQKGK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 14/74 (19%)
HMG20ANP_060670.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113 18/82 (22%)
DUF5401 <59..313 CDD:375164 27/141 (19%)
HMG-box_HMG20A 83..186 CDD:438833 19/105 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..211 3/12 (25%)

Return to query results.
Submit another query.