DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox18

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001123409.1 Gene:sox18 / 100170185 XenbaseID:XB-GENE-483233 Length:362 Species:Xenopus tropicalis


Alignment Length:425 Identity:112/425 - (26%)
Similarity:158/425 - (37%) Gaps:142/425 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GYDWNLVQASAKAPTDRK--KEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNL 118
            ||.:        :|.:.|  ...|:||||||||||:..|:.:::|.|.|.|:.|||.||:.||||
 Frog    53 GYGY--------SPCEEKPGDPRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGQSWKNL 109

  Fly   119 KDSDKKPFMEFAEKLRMTHKQEHPDYKYQPRRKK-----ARVLPSQQSGEGGSPGPEMTLSATMG 178
            ..::|:||:|.||:||:.|.|:||:|||:|||||     .||.||                    
 Frog   110 SSAEKRPFVEEAERLRVQHLQDHPNYKYRPRRKKQAKKLKRVDPS-------------------- 154

  Fly   179 SSGKPRSSNSNGQRRAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQ 243
                |...| .|.|    |.|.|:|......  |...||...:.:                    
 Frog   155 ----PLLRN-EGYR----GQAMANLSHFRDL--HPLGGSGDLESY-------------------- 188

  Fly   244 SLIETGLDSPCSTASSMSSL--TPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVL 306
                 ||.:|     .||.|  ..|:.|....|.             :|:.::|..         
 Frog   189 -----GLPTP-----EMSPLDVVEPSEPAFFPPH-------------MREEADPGP--------- 221

  Fly   307 LEAGREYVAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVSYPAYSYPANGGH 371
                          ::....||..|.|.......:.:..:.:..||:..:..:...|..|..|..
 Frog   222 --------------FRTYQHGVDFGQEKTLREISLPYSSSPSHMGGFLRTPTASAFYYNPHGGSP 272

  Fly   372 FATEEQQ-----QQQALQASEALNYKPAAADIDPKEIDQYFMDQMLPMTQHHHPHHTHPLHH--- 428
            ..|...|     :..||:|.:.|.......|.|..|.|||     |.|::...|.:..|:..   
 Frog   273 ACTPLGQLSPPPEAPALEAMDHLGPAELWGDFDRNEFDQY-----LNMSRTQGPGYPFPMSKLGA 332

  Fly   429 ----PLHHSPPLNSSASLSSACSSASSQQPVAEYY 459
                |...|       ||.||.|.||:    |.||
 Frog   333 PRTIPCEES-------SLISALSDAST----AMYY 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 38/69 (55%)
sox18NP_001123409.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68 4/22 (18%)
SOX-TCF_HMG-box 67..138 CDD:238684 39/70 (56%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 70..83 10/12 (83%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P43680 94..106 6/11 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..159 16/53 (30%)
Important for transcriptional activation. /evidence=ECO:0000250|UniProtKB:P43680 149..209 23/120 (19%)
Sox17_18_mid 173..222 CDD:371880 14/116 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.