DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox15

DIOPT Version :10

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001120046.1 Gene:sox15 / 100145022 XenbaseID:XB-GENE-6455809 Length:199 Species:Xenopus tropicalis


Alignment Length:108 Identity:45/108 - (41%)
Similarity:69/108 - (63%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEH 141
            :||||||||||:...|:.||.::|.:.|||:|:.||::|:.|.:.:::||.|.|::||..|..::
 Frog    22 VKRPMNAFMVWSSGERKRMSARHPKMHNSEISRRLGEIWRGLGEDERRPFREEAKRLRAQHAIDY 86

  Fly   142 PDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPR 184
            |.|||.||:|:      ::.||.....|:..|....||| .||
 Frog    87 PGYKYAPRKKR------KERGEPPKVAPQAPLPCPPGSS-PPR 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 HMG-box_SoxE 76..150 CDD:438840 34/72 (47%)
sox15NP_001120046.1 HMG-box_SOX 22..95 CDD:438820 34/72 (47%)

Return to query results.
Submit another query.