DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox5

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_031753364.1 Gene:sox5 / 100038209 XenbaseID:XB-GENE-487032 Length:763 Species:Xenopus tropicalis


Alignment Length:243 Identity:65/243 - (26%)
Similarity:97/243 - (39%) Gaps:90/243 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SNCSKDRAK-PVETLVLANYALKAEQKKAQGQGGRKEDERITTAVMKVLEGYDWNL---VQASAK 67
            :||..|:.| .:|:|             .|...|:..:::.:.|:|      |:||   ...||.
 Frog   492 NNCRTDKDKSSLESL-------------TQQLTGKPNEDKFSHAMM------DFNLSGDSDGSAG 537

  Fly    68 APTDR----------KKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSD 122
            ....|          .:.|||||||||||||:..||.:.:.:|.:.||.:||.||..||.:.:.:
 Frog   538 ISESRIYRESRGRGSNEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMTNLE 602

  Fly   123 KKPFMEFAEKLRMTHKQEHPDYKYQPR--------RKKARV------------------------ 155
            |:|:.|...:|...|.:::|||||:||        .||.|:                        
 Frog   603 KQPYYEEQARLSKQHLEKYPDYKYKPRPKRTCLVDGKKLRIGEYKAIMRSRRQEMRQYFNVGQQA 667

  Fly   156 ------------------------LPSQQSGEGGSPGPEM-TLSATMG 178
                                    |||:.|....||.|.| .:.:|.|
 Frog   668 QIPISTAGVVYPGAIAMAGMPSPHLPSEHSSVSSSPEPGMPVIQSTYG 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 32/69 (46%)
sox5XP_031753364.1 SOX-TCF_HMG-box 556..627 CDD:238684 33/70 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.