DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox100B and sox21

DIOPT Version :9

Sequence 1:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_002939326.1 Gene:sox21 / 100038091 XenbaseID:XB-GENE-486445 Length:271 Species:Xenopus tropicalis


Alignment Length:301 Identity:88/301 - (29%)
Similarity:128/301 - (42%) Gaps:80/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 EHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQ 139
            :|:||||||||||::|.||.|:::.|.:.|||:||.||..||.|.:::|:||::.|::||..|.:
 Frog     6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTEAEKRPFIDEAKRLRAMHMK 70

  Fly   140 EHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLG 204
            |||||||:||||...:|   :..:...|.|       .|.:|     :.:|.:.||...|     
 Frog    71 EHPDYKYRPRRKPKTLL---KKDKFAFPMP-------YGFTG-----DHDGLKVAGLHGA----- 115

  Fly   205 SCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPATP 269
                       |:.:..:.||.      ..|.||                :.|::.....||:..
 Frog   116 -----------GALTDSLLSNP------EKAAAA----------------AAAAAARVFFPPSAA 147

  Fly   270 YNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVNYQGQSAGVQSG--- 331
            ...|.:.|.|..||:|..|. .||..:|.       :..:.........:.|...|.|...|   
 Frog   148 AAAAAAAAAAGGANHPYSLF-DLSSKMAE-------ITSSSSSLPYTSSIGYPQASGGAFPGVAA 204

  Fly   332 --AEGGGAGQEMDFLENINGYGGYTGSRVS--YPAYSYPAN 368
              |....||            ||:|.|..|  .|.|..|.|
 Frog   205 AAAAAAAAG------------GGHTHSHPSPGNPGYMIPCN 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 38/69 (55%)
sox21XP_002939326.1 SOX-TCF_HMG-box 7..78 CDD:238684 39/70 (56%)
SOXp 77..>95 CDD:372055 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.