DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and CanA-14F

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster


Alignment Length:282 Identity:114/282 - (40%)
Similarity:166/282 - (58%) Gaps:24/282 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGD 71
            |:.:||:.....||:|.   |...:..:.:::      :::|||||||||||||||.:||::||.
  Fly   126 LEGRIEESAALRIIQEG---ATLLRTEKTMID------IEAPVTVCGDIHGQFYDLMKLFEIGGS 181

  Fly    72 VPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGS 136
            .....|||:||:|||||:|:|..|.|.:||:.||..:.|:|||||.|.:|:.:.|..||..|| |
  Fly   182 PATTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-S 245

  Fly   137 TAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDPE 201
            ..|:..|.:.||.|.|:|:::.:..||||||||.|..|:.||.:||.:|.|..|||||||||||.
  Fly   246 ERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPL 310

  Fly   202 DQTG--------WGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNE------T 252
            :..|        ...|.||..|.:.......|.:.|::..|.|||:....|::.:...      :
  Fly   311 EDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS 375

  Fly   253 VLTVWSAPNYCYRCGNVAAILE 274
            ::|::|||||.....|.||:|:
  Fly   376 LITIFSAPNYLDVYNNKAAVLK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 114/282 (40%)
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 114/282 (40%)
PP2Ac 132..403 CDD:197547 111/276 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438864
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.