DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and CMP2

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_013655.1 Gene:CMP2 / 854946 SGDID:S000004521 Length:604 Species:Saccharomyces cerevisiae


Alignment Length:301 Identity:106/301 - (35%)
Similarity:162/301 - (53%) Gaps:39/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKN 76
            :..||...:...:...:...|.|:..:|.|:..|.:|:|||||||||::||.:||:||||....:
Yeast   102 DHFKREGKLSAAQAARIVTLATELFSKEPNLISVPAPITVCGDIHGQYFDLLKLFEVGGDPATTS 166

  Fly    77 YLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTAVWR 141
            |||:||:||||.:|.|..:.|.:||:.:.|...|:|||||.:.:|..:.|.:|.|.|| :..::.
Yeast   167 YLFLGDYVDRGSFSFECLIYLYSLKLNFNDHFWLLRGNHECKHLTSYFTFKNEMLHKY-NLDIYE 230

  Fly   142 YCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDP------ 200
            .|.|.|:.|.|:|:::|:..|||||:||.:..|..|.:::|.:|:|..|.||||||:||      
Yeast   231 KCCESFNNLPLAALMNGQYLCVHGGISPELNSLQDINNLNRFREIPSHGLMCDLLWADPIEEYDE 295

  Fly   201 ---EDQTGWGV-----------------------SPRGAGYLFGSDVVSQFNRTNDIDMICRAHQ 239
               :|.|...:                       |.||..|.|.......|.:...:..|.|||:
Yeast   296 VLDKDLTEEDIVNSKTMVPHHGKMAPSRDMFVPNSVRGCSYAFTYRAACHFLQETGLLSIIRAHE 360

  Fly   240 LVMEGFKWHFN------ETVLTVWSAPNYCYRCGNVAAILE 274
            ....|::.:.|      .::||::|||||.....|.||||:
Yeast   361 AQDAGYRMYKNTKTLGFPSLLTLFSAPNYLDTYNNKAAILK 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 106/301 (35%)
CMP2NP_013655.1 MPP_PP2B 95..423 CDD:277361 106/301 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.