DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and FYPP1

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_175454.1 Gene:FYPP1 / 841459 AraportID:AT1G50370 Length:303 Species:Arabidopsis thaliana


Alignment Length:309 Identity:184/309 - (59%)
Similarity:235/309 - (76%) Gaps:14/309 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGG 70
            |||:.|.::|..:.:.|:|::.||...:|||:||.|||.|:|||||||||||||:||.:||:.||
plant     2 DLDQWISKVKDGQHLSEDELQLLCEYVKEILIEESNVQPVNSPVTVCGDIHGQFHDLMKLFQTGG 66

  Fly    71 DVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYG 135
            .|||.||:||||||||||.|:|.|.:||.||.|:|..|||:||||||||:||||||||||.||||
plant    67 HVPETNYIFMGDFVDRGYNSLEVFTILLLLKARHPANITLLRGNHESRQLTQVYGFYDECQRKYG 131

  Fly   136 STAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDP 200
            :...|||||::||||:|||||||.:.||||||||.::.:||||.|:|..|:||:||.|||:||||
plant   132 NANAWRYCTDVFDYLTLSAIIDGTVLCVHGGLSPDVRTIDQIRLIERNCEIPHEGPFCDLMWSDP 196

  Fly   201 EDQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNET-VLTVWSAPNYCY 264
            ||...|.|||||||:||||.|.::||..|::|::|||||||.||.|:.|.:. ::||||||||||
plant   197 EDIETWAVSPRGAGWLFGSRVTTEFNHINNLDLVCRAHQLVQEGLKYMFQDKGLVTVWSAPNYCY 261

  Fly   265 RCGNVAAILELNEYLHRDFVIFEAAPQESR------GIPSKKPQADYFL 307
            ||||||:||..|:.:.|:...|....:.::      |:|       |||
plant   262 RCGNVASILSFNDNMEREVKFFTETEENNQMRGPRTGVP-------YFL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 179/284 (63%)
FYPP1NP_175454.1 MPP_PP2A_PP4_PP6 2..285 CDD:277360 179/282 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D808922at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.