DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and PP2A-4

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_567066.1 Gene:PP2A-4 / 825019 AraportID:AT3G58500 Length:313 Species:Arabidopsis thaliana


Alignment Length:303 Identity:195/303 - (64%)
Similarity:246/303 - (81%) Gaps:3/303 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGG 70
            |||.||.||.:|:.:.|.:|:|||.||:|||::|.|||.|.||||:||||||||:||.|||::||
plant    13 DLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICGDIHGQFHDLAELFRIGG 77

  Fly    71 DVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYG 135
            ..|:.|||||||:||||||||||..||:.||||||.|||::||||||||||||||||||||||||
plant    78 KCPDTNYLFMGDYVDRGYYSVETVTLLVGLKVRYPQRITILRGNHESRQITQVYGFYDECLRKYG 142

  Fly   136 STAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDP 200
            :..||:..|::|||..|:|:::.:|||:||||||||:.||.||:.||.|||||:|||||||||||
plant   143 NANVWKIFTDLFDYFPLTALVESEIFCLHGGLSPSIETLDNIRNFDRVQEVPHEGPMCDLLWSDP 207

  Fly   201 EDQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYR 265
            :|:.|||:|||||||.||.|:..|||.||::.:|.|||||||:||.|...:.|:|::||||||||
plant   208 DDRCGWGISPRGAGYTFGQDISEQFNHTNNLKLIARAHQLVMDGFNWAHEQKVVTIFSAPNYCYR 272

  Fly   266 CGNVAAILELNEYLHRDFVIFEAAPQESRGIPS-KKPQADYFL 307
            |||:|:|||:::..:..|:.||.||:  ||.|. .:...||||
plant   273 CGNMASILEVDDCRNHTFIQFEPAPR--RGEPDVTRRTPDYFL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 186/283 (66%)
PP2A-4NP_567066.1 MPP_PP2A_PP4_PP6 13..297 CDD:277360 186/283 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D808922at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.