DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and Ppp6c

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_077171.1 Gene:Ppp6c / 67857 MGIID:1915107 Length:305 Species:Mus musculus


Alignment Length:302 Identity:183/302 - (60%)
Similarity:235/302 - (77%) Gaps:1/302 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGG 70
            |||:.:|..::|:.:.||::|.||....::|:||.|||.|.:|||||||||||||||.|||:.||
Mouse     5 DLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGG 69

  Fly    71 DVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYG 135
            .||:.||:||||||||||||:|||..|||||.::||||||:|||||||||||||||||||..|||
Mouse    70 QVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYG 134

  Fly   136 STAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDP 200
            :...|||||::||.|:::|:||.:|.||||||||.|:.|||||:|:|.||:||.|..|||:||||
Mouse   135 NANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDP 199

  Fly   201 EDQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYR 265
            ||...|.:||||||:|||:.|.::|...|::.:||||||||.||:|:.|:|.::|||||||||||
Mouse   200 EDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYR 264

  Fly   266 CGNVAAILELNEYLHRDFVIFEAAPQESRGIPSKKPQADYFL 307
            |||:|:|:...:...|:..:|.|.|...|.|| .:....|||
Mouse   265 CGNIASIMVFKDVNTREPKLFRAVPDSERVIP-PRTTTPYFL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 176/283 (62%)
Ppp6cNP_077171.1 MPP_PP2A_PP4_PP6 5..289 CDD:277360 176/283 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.