DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and Ppp5c

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_006228527.2 Gene:Ppp5c / 65179 RGDID:68415 Length:594 Species:Rattus norvegicus


Alignment Length:258 Identity:116/258 - (44%)
Similarity:154/258 - (59%) Gaps:9/258 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VTVCGDIHGQFYDLKELFKVGGDVPEKN-YLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIR 112
            :|||||.|||||||..:|::.|...|.| |:|.|||||||.:|||..|.|...|:.|||...|:|
  Rat   332 ITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLR 396

  Fly   113 GNHESRQITQVYGFYDECLRKYGSTAVWRYCTEIFDYLSLSAIIDGKIFCVHGGL-SPSIQYLDQ 176
            ||||:..:.|:|||..|...|| :..::...:|:|::|.|:..|:||:..:|||| |.....||.
  Rat   397 GNHETDNMNQIYGFEGEVKAKY-TAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDD 460

  Fly   177 IRSIDRKQEVPHDGPMCDLLWSDPEDQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLV 241
            ||.|:|.::.|..|||||||||||:.|.|..||.||....||.||...|...|.:|.|.|:|::.
  Rat   461 IRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTKAFLEENQLDYIIRSHEVK 525

  Fly   242 MEGFKWHFNETVLTVWSAPNYCYRCGNVAAILEL-NEYLHRDFVIFEAAPQESRGIPSKKPQA 303
            .||::.......:||:||||||.:.||.|:.:.| ...|...|..|.|.|.     |:.||.|
  Rat   526 AEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPH-----PNVKPMA 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 111/243 (46%)
Ppp5cXP_006228527.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.