DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and PPP3CA

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_000935.1 Gene:PPP3CA / 5530 HGNCID:9314 Length:521 Species:Homo sapiens


Alignment Length:283 Identity:117/283 - (41%)
Similarity:168/283 - (59%) Gaps:25/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RCEIIKENEVK----------ALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGG 70
            |.:|:|.:.:|          .:..:...||.:|.|:..:|:||||||||||||:||.:||:|||
Human    42 RVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGG 106

  Fly    71 DVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYG 135
            ......|||:||:|||||:|:|..|.|.|||:.||..:.|:|||||.|.:|:.:.|..||..|| 
Human   107 SPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKY- 170

  Fly   136 STAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDP 200
            |..|:..|.:.||.|.|:|:::.:..||||||||.|..||.||.:||.:|.|..|||||:|||||
Human   171 SERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDP 235

  Fly   201 EDQTG--------WGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNE------ 251
            .:..|        ...:.||..|.:....|.:|.:.|::..|.|||:....|::.:...      
Human   236 LEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP 300

  Fly   252 TVLTVWSAPNYCYRCGNVAAILE 274
            :::|::|||||.....|.||:|:
Human   301 SLITIFSAPNYLDVYNNKAAVLK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 117/283 (41%)
PPP3CANP_000935.1 MPP_PP2B 41..345 CDD:277361 117/283 (41%)
Catalytic. /evidence=ECO:0000305 56..340 113/269 (42%)
SAPNY motif. /evidence=ECO:0000305|PubMed:26248042 307..311 3/3 (100%)
Interaction with PxIxIF motif in substrate. /evidence=ECO:0000269|PubMed:17498738, ECO:0000269|PubMed:17502104, ECO:0000269|PubMed:22343722, ECO:0000269|PubMed:23468591, ECO:0000269|PubMed:26248042 327..336
Calcineurin B binding. /evidence=ECO:0000269|PubMed:12218175, ECO:0000269|PubMed:12357034, ECO:0000269|PubMed:17498738, ECO:0000269|PubMed:23468591, ECO:0000269|PubMed:27974827, ECO:0000269|PubMed:8524402 341..369
Calmodulin-binding. /evidence=ECO:0000269|PubMed:18384083, ECO:0000269|PubMed:19404396, ECO:0000269|PubMed:25144868, ECO:0000269|Ref.31 392..406
Autoinhibitory segment. /evidence=ECO:0000250|UniProtKB:P16298 407..414
Autoinhibitory domain. /evidence=ECO:0000269|PubMed:8524402 465..487
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..521
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.