DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and ppp2cb

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001005443.1 Gene:ppp2cb / 448031 XenbaseID:XB-GENE-957248 Length:309 Species:Xenopus tropicalis


Alignment Length:303 Identity:195/303 - (64%)
Similarity:245/303 - (80%) Gaps:3/303 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGG 70
            :||:.||||..|:.:.|::|:.||.||:|||.:|.|||.|..|||||||:||||:||.|||::||
 Frog     9 ELDQWIEQLNDCKQLNESQVRTLCEKAKEILTKESNVQDVRCPVTVCGDVHGQFHDLMELFRIGG 73

  Fly    71 DVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYG 135
            ..|:.|||||||:||||||||||..||:|||||||:|||::||||||||||||||||||||||||
 Frog    74 KSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYG 138

  Fly   136 STAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDP 200
            :..||:|.|::||||.|:|::||:|||:||||||||..||.||::||.|||||:|||||||||||
 Frog   139 NANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDP 203

  Fly   201 EDQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYR 265
            :|:.|||:|||||||.||.|:...||..|.:.::.|||||||||:.|..:..|:|::||||||||
 Frog   204 DDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYR 268

  Fly   266 CGNVAAILELNEYLHRDFVIFEAAPQESRGIPS-KKPQADYFL 307
            |||.|||:||::.|...|:.|:.||:  ||.|. .:...||||
 Frog   269 CGNQAAIMELDDTLKYSFLQFDPAPR--RGEPHVTRRTPDYFL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 186/283 (66%)
ppp2cbNP_001005443.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 186/283 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.