DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and CanA1

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001247378.2 Gene:CanA1 / 43670 FlyBaseID:FBgn0010015 Length:622 Species:Drosophila melanogaster


Alignment Length:282 Identity:117/282 - (41%)
Similarity:169/282 - (59%) Gaps:24/282 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGD 71
            |:.:||:.....||.|...         :|.||.|:..|::|:||||||||||:||.:||:|||.
  Fly    92 LEGRIEEAVALRIITEGAA---------LLREEKNMIDVEAPITVCGDIHGQFFDLVKLFEVGGP 147

  Fly    72 VPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGS 136
            .....|||:||:|||||:|:|..|.|.:||:.||..::|:|||||.|.:|:.:.|..||:.|| |
  Fly   148 PATTRYLFLGDYVDRGYFSIECVLYLWSLKITYPTTLSLLRGNHECRHLTEYFTFKQECIIKY-S 211

  Fly   137 TAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDPE 201
            .:::..|.|.||.|.|:|:::.:..|:||||||.|..||.|::::|.:|.|..|||||||||||.
  Fly   212 ESIYDACMEAFDCLPLAALLNQQFLCIHGGLSPEIFTLDDIKTLNRFREPPAYGPMCDLLWSDPL 276

  Fly   202 DQTG--------WGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETV----- 253
            :..|        ...|.||..|.|......:|.:.|::..|.|||:....|::.:....|     
  Fly   277 EDFGNEKTNEFFSHNSVRGCSYFFSYSACCEFLQKNNLLSIVRAHEAQDAGYRMYRKNQVTGFPS 341

  Fly   254 -LTVWSAPNYCYRCGNVAAILE 274
             :|::|||||.....|.||:|:
  Fly   342 LITIFSAPNYLDVYNNKAAVLK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 117/282 (41%)
CanA1NP_001247378.2 MPP_PP2B 81..385 CDD:277361 117/282 (41%)
PP2Ac 98..369 CDD:197547 114/276 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438865
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.