DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and ppp1cc

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_998835.1 Gene:ppp1cc / 407879 XenbaseID:XB-GENE-967934 Length:323 Species:Xenopus tropicalis


Alignment Length:285 Identity:135/285 - (47%)
Similarity:198/285 - (69%) Gaps:9/285 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFV 84
            ::|||::.||.|:|||.:.:..:..:::|:.:|||||||:|||..||:.||..||.||||:||:|
 Frog    30 LQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYV 94

  Fly    85 DRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTAVWRYCTEIFDY 149
            |||..|:||..||||.|::||:...|:|||||...|.::|||||||.|:| :..:|:..|:.|:.
 Frog    95 DRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNC 158

  Fly   150 LSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDPE-DQTGWGVSPRGA 213
            |.::||:|.||||.||||||.:|.::|||.|.|..:||..|.:||||||||: |..|||.:.||.
 Frog   159 LPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGV 223

  Fly   214 GYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYRCGNVAAILELNEY 278
            .:.||::||::|...:|:|:||||||:|.:|:::.....::|::||||||....|..|::.::|.
 Frog   224 SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDET 288

  Fly   279 LHRDFVIFEAAPQESRGIPSKKPQA 303
            |...|.|.:.|.:       |||.|
 Frog   289 LMCSFQILKPAEK-------KKPNA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 130/270 (48%)
ppp1ccNP_998835.1 MPP_PP1_PPKL 8..298 CDD:277359 130/268 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..323 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.