DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and CG11597

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster


Alignment Length:300 Identity:169/300 - (56%)
Similarity:211/300 - (70%) Gaps:3/300 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SDLDRQIEQLKR--CEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFK 67
            :|.||.:|.|:.  ..:.:|.||:.||....::||.|.|:..:.||..|||||||||.||..|.:
  Fly    11 NDADRLVENLRHVPVRLPRELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLE 75

  Fly    68 VGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLR 132
            :||.|.|..|||:||.||||..||||||||.|||||:|.:::|:|||||.|..|:.||||:|||.
  Fly    76 LGGSVQEHRYLFLGDLVDRGKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLS 140

  Fly   133 KYGSTAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLW 197
            :|||..|||.|..:||.|.|:|||||.|.||||||||.:|.||.:||:||..|:|..|.:.||||
  Fly   141 RYGSANVWRMCCRVFDLLPLAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLW 205

  Fly   198 SDPEDQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNY 262
            |||::..||..||||.|.|||.|||.:|.|.|.|.:|||||||..:||:|||.:.::|:||||||
  Fly   206 SDPQEAPGWAASPRGHGKLFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNY 270

  Fly   263 CYRCGNVAAILELNEYLHRDFVIFEAAPQESRGIPSKKPQ 302
            ||||||.||||.||.....||.:|||....|:..| :||:
  Fly   271 CYRCGNKAAILRLNAAGDYDFKVFEAQALHSKPQP-RKPK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 165/285 (58%)
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 167/295 (57%)
MPP_superfamily 12..296 CDD:301300 163/283 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455377
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45619
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.