DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and Ppp1cb

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_037197.1 Gene:Ppp1cb / 25594 RGDID:3376 Length:327 Species:Rattus norvegicus


Alignment Length:285 Identity:132/285 - (46%)
Similarity:197/285 - (69%) Gaps:6/285 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFVDR 86
            |.||:.||.|:|||.:.:..:..:::|:.:|||||||:.||..||:.||..||.||||:||:|||
  Rat    31 EAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDR 95

  Fly    87 GYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTAVWRYCTEIFDYLS 151
            |..|:||..||||.|::||:...|:|||||...|.::|||||||.|:: :..:|:..|:.|:.|.
  Rat    96 GKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRF-NIKLWKTFTDCFNCLP 159

  Fly   152 LSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDPE-DQTGWGVSPRGAGY 215
            ::||:|.||||.||||||.:|.::|||.|.|..:||..|.:||||||||: |..|||.:.||..:
  Rat   160 IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSF 224

  Fly   216 LFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYRCGNVAAILELNEYLH 280
            .||:||||:|...:|:|:||||||:|.:|:::.....::|::||||||....|...::.::|.|.
  Rat   225 TFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLM 289

  Fly   281 RDFVIFEAAPQESR----GIPSKKP 301
            ..|.|.:.:.::::    |:.|.:|
  Rat   290 CSFQILKPSEKKAKYQYGGLNSGRP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 129/268 (48%)
Ppp1cbNP_037197.1 MPP_PP1_PPKL 7..297 CDD:277359 129/266 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.