DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and Ppp1ca

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_113715.1 Gene:Ppp1ca / 24668 RGDID:3375 Length:330 Species:Rattus norvegicus


Alignment Length:271 Identity:131/271 - (48%)
Similarity:192/271 - (70%) Gaps:2/271 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFV 84
            :.|||::.||.|:|||.:.:..:..:::|:.:|||||||:|||..||:.||..||.||||:||:|
  Rat    30 LTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYV 94

  Fly    85 DRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTAVWRYCTEIFDY 149
            |||..|:||..||||.|::||:...|:|||||...|.::|||||||.|:| :..:|:..|:.|:.
  Rat    95 DRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNC 158

  Fly   150 LSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDPE-DQTGWGVSPRGA 213
            |.::||:|.||||.||||||.:|.::|||.|.|..:||..|.:||||||||: |..|||.:.||.
  Rat   159 LPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGV 223

  Fly   214 GYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYRCGNVAAILELNEY 278
            .:.||::||::|...:|:|:||||||:|.:|:::.....::|::||||||....|..|::.::|.
  Rat   224 SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDET 288

  Fly   279 LHRDFVIFEAA 289
            |...|.|.:.|
  Rat   289 LMCSFQILKPA 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 131/271 (48%)
Ppp1caNP_113715.1 MPP_PP1_PPKL 8..298 CDD:277359 130/268 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.