DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and Ppp1cb

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_766295.2 Gene:Ppp1cb / 19046 MGIID:104871 Length:327 Species:Mus musculus


Alignment Length:285 Identity:132/285 - (46%)
Similarity:197/285 - (69%) Gaps:6/285 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFVDR 86
            |.||:.||.|:|||.:.:..:..:::|:.:|||||||:.||..||:.||..||.||||:||:|||
Mouse    31 EAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDR 95

  Fly    87 GYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTAVWRYCTEIFDYLS 151
            |..|:||..||||.|::||:...|:|||||...|.::|||||||.|:: :..:|:..|:.|:.|.
Mouse    96 GKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRF-NIKLWKTFTDCFNCLP 159

  Fly   152 LSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDPE-DQTGWGVSPRGAGY 215
            ::||:|.||||.||||||.:|.::|||.|.|..:||..|.:||||||||: |..|||.:.||..:
Mouse   160 IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSF 224

  Fly   216 LFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYRCGNVAAILELNEYLH 280
            .||:||||:|...:|:|:||||||:|.:|:::.....::|::||||||....|...::.::|.|.
Mouse   225 TFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLM 289

  Fly   281 RDFVIFEAAPQESR----GIPSKKP 301
            ..|.|.:.:.::::    |:.|.:|
Mouse   290 CSFQILKPSEKKAKYQYGGLNSGRP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 129/268 (48%)
Ppp1cbNP_766295.2 MPP_PP1_PPKL 7..297 CDD:277359 129/266 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.