DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and C24H11.1

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_499527.1 Gene:C24H11.1 / 182859 WormBaseID:WBGene00007699 Length:384 Species:Caenorhabditis elegans


Alignment Length:256 Identity:95/256 - (37%)
Similarity:151/256 - (58%) Gaps:11/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRIT 109
            :.:|:.:|||.|||:.||..:|...|...:..|||:||:||||.:|:|..:||.:||:..|.::.
 Worm   110 LQAPINICGDTHGQYNDLLRIFNACGAATKTQYLFLGDYVDRGGHSLEVIMLLFSLKLAMPRKMH 174

  Fly   110 LIRGNHESRQITQVYGFYDECLRKYGS----TAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPS 170
            |:|||||.:.|.:.|||:.|..:::..    .:|:.:..::|.|:.|.||:..:|.|:|||:||.
 Worm   175 LLRGNHELKAINKNYGFHAELKKRFQREEVYESVYNHFNQVFSYMPLCAIVSKRILCMHGGISPH 239

  Fly   171 IQYLDQIRSIDRKQEVPHDGPM-CDLLWSDPEDQTGWGVSP---RGAGYLFGSDVVSQFNRTNDI 231
            ::.||.||:|....|.....|: |||||:||| :...|..|   |....:||...|....:..||
 Worm   240 LKSLDDIRAIPLPLETAKTHPLACDLLWADPE-KDAKGFEPNKIRAISNVFGKKEVDDLCKRLDI 303

  Fly   232 DMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYRCGNVAAILELNEYLHRDFVIFEAAPQE 292
            |:|.||||:|..|:.:..:..::||:||..|.....|.||::.:|:.|...||  :..|::
 Worm   304 DLIVRAHQVVEYGYAFFADRRLITVFSASRYQIELCNYAAVVVVNKMLELSFV--QLKPED 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 94/252 (37%)
C24H11.1NP_499527.1 MPP_superfamily 43..360 CDD:301300 94/252 (37%)
PP2Ac 106..360 CDD:197547 94/252 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.