DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and tax-6

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001367052.1 Gene:tax-6 / 177943 WormBaseID:WBGene00006527 Length:545 Species:Caenorhabditis elegans


Alignment Length:281 Identity:118/281 - (41%)
Similarity:163/281 - (58%) Gaps:20/281 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QLKRCEIIKENEVKALCA-----KAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDV 72
            ::.|...|||..::...|     :...:...|..:..:::|||||||||||||||.:||:|||..
 Worm    69 EVLRDHFIKEGRIEEEAAIRVIQECSSLFRNEKTMLEIEAPVTVCGDIHGQFYDLMKLFEVGGSP 133

  Fly    73 PEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGST 137
            ....|||:||:|||||:|:|..|.|.|||:.||..:.|:|||||.|.:|:.:.|..||..|| |.
 Worm   134 ATTKYLFLGDYVDRGYFSIECVLYLWALKICYPTTLFLLRGNHECRHLTEYFTFKQECKIKY-SE 197

  Fly   138 AVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDPED 202
            .|:..|.|.||.|.|:|:::.:..||||||||.|..|:.||.|||.:|.|..|||||||||||.:
 Worm   198 RVYDVCMESFDALPLAALMNQQFLCVHGGLSPEIHTLEDIRRIDRFKEPPAFGPMCDLLWSDPLE 262

  Fly   203 QTG--------WGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNE------TV 253
            ..|        ...|.||..|.:.......|.:.|::..|.|||:....|::.:...      ::
 Worm   263 DFGNERNSEQFSHNSVRGCSYFYSYAACCDFLQHNNLLSIIRAHEAQDAGYRMYRKSQATGFPSL 327

  Fly   254 LTVWSAPNYCYRCGNVAAILE 274
            :|::|||||.....|.||||:
 Worm   328 ITIFSAPNYLDVYNNKAAILK 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 118/281 (42%)
tax-6NP_001367052.1 MPP_PP2B 66..370 CDD:277361 118/281 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.