DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and F26B1.5

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001040654.1 Gene:F26B1.5 / 172328 WormBaseID:WBGene00017817 Length:383 Species:Caenorhabditis elegans


Alignment Length:301 Identity:95/301 - (31%)
Similarity:152/301 - (50%) Gaps:42/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELF-----------KVG 69
            |..:.:::::..|..:..|:...|..:..:..|||:.||||||:.||..:.           |:.
 Worm    27 RQHVYEKSDLLLLIGQIMELFKMEKTLATISPPVTIVGDIHGQYPDLVRILNSRISKEEAKQKIV 91

  Fly    70 GDVPEKNYLFMGDFVDRGYYSVETFLLLLALKV---------------RYPDRITLIRGNHESRQ 119
            .......::|:||:||||.:|:|...|:.||||               .||....|:|||||::.
 Worm    92 TSYSSNRFVFLGDYVDRGNHSIECICLVFALKVLDLKFVSLLVIMFQIAYPTNFVLLRGNHETKA 156

  Fly   120 ITQVYGFYDECLRKYGST---AVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSID 181
            |...|||.:|...:.|..   .:|....|:|.::.|:.::.|:|.|:|||:|..::.||.|.||.
 Worm   157 INFAYGFREELENRLGKKDGFEIWEKFNEVFSFMPLACLVGGRILCMHGGISEKLESLDSIDSIV 221

  Fly   182 RKQEVPHDGPMC-DLLWSDPED-QTGWGVSP---------RGAGYLFGSDVVSQFNRTNDIDMIC 235
            |  .:|....:. |||||||.| ||...:|.         ||..:.|....|....|..::.::.
 Worm   222 R--PLPEVTDLAQDLLWSDPMDVQTLASISDTPKYAKNIVRGLAHSFNDAAVRDVCRRLNLHLVV 284

  Fly   236 RAHQLVMEGFKWHFNETVLTVWSAPNYCYRCGNVAAILELN 276
            ||||::.||||::.:..:||::|||.|.....|..|.|:::
 Worm   285 RAHQMIPEGFKFNSDRKLLTIFSAPRYMNESDNRGATLQVD 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 95/301 (32%)
F26B1.5NP_001040654.1 PP2Ac 31..339 CDD:197547 94/297 (32%)
MPP_PPP_family 61..324 CDD:277316 89/264 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.