DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and Ppp6c

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_598273.2 Gene:Ppp6c / 171121 RGDID:708460 Length:305 Species:Rattus norvegicus


Alignment Length:302 Identity:183/302 - (60%)
Similarity:235/302 - (77%) Gaps:1/302 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGG 70
            |||:.:|..::|:.:.||::|.||....::|:||.|||.|.:|||||||||||||||.|||:.||
  Rat     5 DLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGG 69

  Fly    71 DVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYG 135
            .||:.||:||||||||||||:|||..|||||.::||||||:|||||||||||||||||||..|||
  Rat    70 QVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYG 134

  Fly   136 STAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSDP 200
            :...|||||::||.|:::|:||.:|.||||||||.|:.|||||:|:|.||:||.|..|||:||||
  Rat   135 NANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDP 199

  Fly   201 EDQTGWGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNETVLTVWSAPNYCYR 265
            ||...|.:||||||:|||:.|.::|...|::.:||||||||.||:|:.|:|.::|||||||||||
  Rat   200 EDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYR 264

  Fly   266 CGNVAAILELNEYLHRDFVIFEAAPQESRGIPSKKPQADYFL 307
            |||:|:|:...:...|:..:|.|.|...|.|| .:....|||
  Rat   265 CGNIASIMVFKDVNTREPKLFRAVPDSERVIP-PRTTTPYFL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 176/283 (62%)
Ppp6cNP_598273.2 MPP_PP2A_PP4_PP6 5..289 CDD:277360 176/283 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.