DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and ppef1

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_031752607.1 Gene:ppef1 / 100496625 XenbaseID:XB-GENE-6037564 Length:700 Species:Xenopus tropicalis


Alignment Length:380 Identity:98/380 - (25%)
Similarity:159/380 - (41%) Gaps:97/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SDLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDS----PVTVCGDIHGQFYDLKEL 65
            ||.:..:...|:.:.:....|..|..:.::.|.:..|:..:.:    .:|:|||:||:..||..:
 Frog   125 SDTNALLRAFKQGQQLHARYVLQLFHETKKFLKQLPNIVHLSTSYSKEITICGDLHGKLDDLLLI 189

  Fly    66 F-KVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDE 129
            | |.|....|.:|||.||.||||..|:|..:||....:.||:.:.:.|||||...:...|||.:|
 Frog   190 FYKNGLPSTENHYLFNGDLVDRGKNSIEILVLLFTFLLMYPNNVHINRGNHEDPIMNLRYGFTNE 254

  Fly   130 CLRKYGSTA--VWRYCTEIFDYLSLSAIIDGKIFCVHGGL------------------------- 167
            .::||...|  :.....:|:..|.|:.|:|.|:..:|||:                         
 Frog   255 VIQKYKGHARNILLLLEDIYSRLPLATIVDSKVLILHGGIGDKTDLDFLSSIDRFKYKSALRTPK 319

  Fly   168 ---------------------------------------------------SP---SIQYLD-QI 177
                                                               ||   .|.|:| :|
 Frog   320 TDSEKCTSRDKMLDGKNKKSSVDVGANQNRANKHMTTSSNISQNRSQQGFRSPGILEINYMDSRI 384

  Fly   178 RSIDRKQEVPHD-----GPMCDLLWSDPEDQTGWGVSP---RGAGYLFGSDVVSQFNRTNDIDMI 234
            :..|:..|:|..     ..:.|:|||||.:|.  |.:|   ||.|..||.:|..:.....:..|:
 Frog   385 QLPDKMPELPDSIRKEWKQVVDILWSDPRNQN--GCTPNSFRGGGCYFGPNVTKKLLAKYNFKML 447

  Fly   235 CRAHQLVMEGFKWHFNETVLTVWSAPNYCYRCGNVAAILELNEYLHRDFVIFEAA 289
            .|:|:...||::...|..|:|::||.||.....|..|.|:|:..|...||.::.:
 Frog   448 IRSHECKQEGYELCHNGKVVTIFSASNYYDEGSNRGAYLKLSPDLTPRFVPYQVS 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 97/379 (26%)
ppef1XP_031752607.1 MPP_superfamily 121..500 CDD:417454 98/376 (26%)
FRQ1 535..683 CDD:227455
EF-hand_7 616..684 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.