DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp4-19C and ppp3cb

DIOPT Version :9

Sequence 1:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_012813808.1 Gene:ppp3cb / 100037840 XenbaseID:XB-GENE-949827 Length:531 Species:Xenopus tropicalis


Alignment Length:284 Identity:120/284 - (42%)
Similarity:172/284 - (60%) Gaps:21/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QIEQLKRCEIIKEN--EVKALCAKARE---ILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVG 69
            |:|.||. .:|||.  |.:|.....||   ||.:|..:..|::|:||||||||||:||.:||:||
 Frog    64 QLETLKN-HLIKEGRLEEEAALRIIREGAAILRQEKTMLEVEAPITVCGDIHGQFFDLMKLFEVG 127

  Fly    70 GDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKY 134
            |......|||:||:|||||:|:|..|.|.:||:.:|..:.|:|||||.|.:|:.:.|..||..||
 Frog   128 GTPHNTRYLFLGDYVDRGYFSIECVLYLWSLKIIHPKTLFLLRGNHECRHLTEYFTFKQECKIKY 192

  Fly   135 GSTAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVPHDGPMCDLLWSD 199
             |..|:..|.:.||.|.|:|:::.:..||||||||.|..||.||.:||.:|.|..||||||||||
 Frog   193 -SERVYDSCMDAFDCLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPAFGPMCDLLWSD 256

  Fly   200 PEDQTG--------WGVSPRGAGYLFGSDVVSQFNRTNDIDMICRAHQLVMEGFKWHFNE----- 251
            |.:..|        ...:.||..|.:....|.:|.::|::..:.|||:....|::.:...     
 Frog   257 PAEDYGSEKTLEHFTHNTVRGCSYFYSYPAVCEFLQSNNLLSVIRAHEAQDAGYRMYRKSQTTGF 321

  Fly   252 -TVLTVWSAPNYCYRCGNVAAILE 274
             :::|::|||||.....|.||:|:
 Frog   322 PSLITIFSAPNYLDVYNNKAAVLK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 120/284 (42%)
ppp3cbXP_012813808.1 MPP_PP2B 63..367 CDD:277361 120/284 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.