DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zfrp8 and pdcd2l

DIOPT Version :9

Sequence 1:NP_001286828.1 Gene:Zfrp8 / 45021 FlyBaseID:FBgn0021875 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001007508.2 Gene:pdcd2l / 493234 XenbaseID:XB-GENE-5805051 Length:355 Species:Xenopus tropicalis


Alignment Length:390 Identity:104/390 - (26%)
Similarity:150/390 - (38%) Gaps:108/390 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGF---AEKSDNGAWLSNRYFPSKLGGQPAWLELEALPPTSQL--QCSKCRAPKSFLAQLYAPFE 64
            |||   .::||..:|     ..||:||.|     :|||...:|  .|..|.|....:.|:|.|.|
 Frog    12 LGFKDALQESDASSW-----DVSKIGGLP-----DALPSVRKLLPSCGLCSAVLCHVVQVYCPME 66

  Fly    65 DEYNFHRSIYVFLCRNSDCQEAQNASNFTVLRSQ-------------LPRK-------------N 103
            .. .|||.::||.|....|...:  .::..||||             :|:|             |
 Frog    67 GS-PFHRVVHVFACSRKPCWGKR--ESWVALRSQSLEGHGPQMKETTVPQKDNAVPTDWCEDADN 128

  Fly   104 KFFSEEEPSDVGQPL---------PAVPCLKKLCAACGCHAPHACSKCKAIHYCSPEHQRAHWPQ 159
            ....:|||.....|:         ||.|          .|...:             .|..|...
 Frog   129 WGLEDEEPVVRISPITANFQATNNPAAP----------THTDFS-------------FQLEHLTL 170

  Fly   160 HKPNCGAPEVATEKPLTQIVFPEFEIVMDSNPVESGEEDKDDEAR-LAEFQELESSGKTGD--LS 221
            .....|.....|       |||.:.|.:......:.:.|.:...| |.|:::.|  |:..|  .|
 Frog   171 SDKMDGVQTAET-------VFPSYYIAVAEEEECTWKGDLNHAQRLLKEYEQRE--GRLSDEPES 226

  Fly   222 NVSEAEMDKYFGNSAAADDKTFRQFKKQTAAEPDQIVRYKRGGQPLWITNTVKTVEDQLNKLPNC 286
            .|.:.|.:||........|..|.:|.|:.:....||:||...|.||:|:......|.|     .|
 Frog   227 CVGKGESEKYEKCDLPNSDILFYKFLKKISTCRQQILRYSWNGTPLYISPPDAASEPQ-----PC 286

  Fly   287 IACGGERQFEFQIMPQALTLLEDEN----LDWGVLAVYTCAKSC-------PIDGYVEELLIKQD 340
            ..|||.|.||||:||..::||:|..    |::|.:.|:||.:||       |    |:|..|.|:
 Frog   287 TQCGGRRVFEFQLMPALVSLLQDAGTDVLLEFGTVLVFTCERSCWEVGDRMP----VQEFCIVQE 347

  Fly   341  340
             Frog   348  347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zfrp8NP_001286828.1 zf-MYND 128..164 CDD:280009 3/35 (9%)
PDCD2_C 238..340 CDD:282100 39/112 (35%)
pdcd2lNP_001007508.2 PDCD2_C 230..347 CDD:398046 42/125 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54449
OrthoDB 1 1.010 - - D1181470at2759
OrthoFinder 1 1.000 - - FOG0001596
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1686
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.