DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zfrp8 and SmydA-5

DIOPT Version :9

Sequence 1:NP_001286828.1 Gene:Zfrp8 / 45021 FlyBaseID:FBgn0021875 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_610202.3 Gene:SmydA-5 / 35538 FlyBaseID:FBgn0033061 Length:553 Species:Drosophila melanogaster


Alignment Length:86 Identity:31/86 - (36%)
Similarity:41/86 - (47%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CAACGCHAPHACSKCKAIHYCSPEHQRAHWPQHKPNCGA------PEVATEKPLTQIVFPEFEIV 186
            |..||..|..||::||.:.||..|||:.||||||..|..      .|:.....:||.: ...:||
  Fly     7 CPVCGVAASQACTRCKMVRYCDREHQKQHWPQHKRRCRPFSEEQDAELGRYLKVTQNI-AAGQIV 70

  Fly   187 MDSNPVESGEE----DKDDEA 203
            ....|:..|.:    |.|.||
  Fly    71 FIEEPLVVGPKWYLSDADKEA 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zfrp8NP_001286828.1 zf-MYND 128..164 CDD:280009 19/35 (54%)
PDCD2_C 238..340 CDD:282100
SmydA-5NP_610202.3 zf-MYND 7..43 CDD:280009 19/35 (54%)
SET 185..295 CDD:279228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18632
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.