DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Ae and CG1136

DIOPT Version :10

Sequence 1:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster


Alignment Length:90 Identity:22/90 - (24%)
Similarity:42/90 - (46%) Gaps:12/90 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLIVFVAIFAFALANEAQIIN---LESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAVQ 64
            :|:..||:.|....::....|   :::|.|||.: :.|:|..||....|..        :...|.
  Fly     4 WLLALVALAAVVTGSQTPSANQYHIQTDEGPERY-FRFQTDSGQFRKEKRL--------QDGTVI 59

  Fly    65 GSFRFVADDGQTYEVNYIADENGFQ 89
            |:..::...|...:.:||||:.|::
  Fly    60 GTEAWIDAAGYLRQKDYIADKQGYR 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:459790 12/54 (22%)
CG1136NP_647853.1 None

Return to query results.
Submit another query.