DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Lcp65Ab1

DIOPT Version :9

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_524814.2 Gene:Lcp65Ab1 / 48382 FlyBaseID:FBgn0020644 Length:104 Species:Drosophila melanogaster


Alignment Length:103 Identity:60/103 - (58%)
Similarity:76/103 - (73%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVFVALFALAVAD---VQILKQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEALNV 62
            ||||||||||||:|||.   .:|::|.|||.|..::...|||||:|.:..|.|||.|||.||..|
  Fly     1 MKFLIVFVALFAMAVARPNLAEIVRQVSDVEPEKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVV 65

  Fly    63 KGTYSFVAD-DGQTYSIAYTADENGYQPQGAHLPVAPV 99
            .|::::|.: .|:.::|.|.||||||||||||||||||
  Fly    66 HGSFTWVDEKTGEKFTITYVADENGYQPQGAHLPVAPV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 25/55 (45%)
Lcp65Ab1NP_524814.2 Chitin_bind_4 40..91 CDD:306811 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466887
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.