DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Lcp65Ae

DIOPT Version :9

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:98 Identity:64/98 - (65%)
Similarity:78/98 - (79%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVFVALFALAVA-DVQILKQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEALNVKG 64
            |||||||||:||.|:| :.||:..||||||.:|.:.:|||||.:|.|.||||...||.|:|.|:|
  Fly     1 MKFLIVFVAIFAFALANEAQIINLESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAVQG 65

  Fly    65 TYSFVADDGQTYSIAYTADENGYQPQGAHLPVA 97
            ::.|||||||||.:.|.|||||:||||||||||
  Fly    66 SFRFVADDGQTYEVNYIADENGFQPQGAHLPVA 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 32/54 (59%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:278791 32/54 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.