DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr67Fb

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:102 Identity:37/102 - (36%)
Similarity:56/102 - (54%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VFVALF---ALAVAD---VQILKQESDVGP-VSFNYGYETSDGSSAQAAGQLKNVGTDEEALNVK 63
            :.::||   |:..||   .:..|..:::.| .|:::.|.||:|..||.:|    ||    .:...
  Fly     6 LIISLFLVAAIRAADESQAETTKYRNEIKPDGSYSWEYGTSNGIDAQESG----VG----GVQAA 62

  Fly    64 GTYSFVADDGQTYSIAYTADENGYQPQGAHLPVAPVV 100
            |:.|:.|.||....:.||||||||:|.|||||..|.:
  Fly    63 GSVSYAAPDGTPIQLEYTADENGYRPTGAHLPTPPPI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 20/54 (37%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.