DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr65Eb

DIOPT Version :9

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:108 Identity:37/108 - (34%)
Similarity:53/108 - (49%) Gaps:28/108 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIVFVALFAL------------AVADVQI----LKQESDVGPVSFNYGYETSDGSSAQAAGQLKN 52
            ::|.||:..|            |.|:::.    ||||..:    :||.:|||:|.:.|..|    
  Fly     6 VVVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGI----YNYQFETSNGIAQQEQG---- 62

  Fly    53 VGTDEEALNVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLP 95
            ||    .....|:..:...:||...:.|||||||:||||.|||
  Fly    63 VG----GYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 19/54 (35%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:278791 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.