DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr65Aw

DIOPT Version :9

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster


Alignment Length:93 Identity:38/93 - (40%)
Similarity:56/93 - (60%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIVFVALFALAVADVQILKQESD-VGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEALNVKGTYS 67
            |:.|.|..:.|....|||:.::: :....:.:.:|||||.|.:....|||.||.|||:.::|:..
  Fly    12 LVSFCACSSNATDTAQILRYDNENMDSDGYAFSFETSDGISREERATLKNPGTPEEAIAIQGSVH 76

  Fly    68 FVADDGQTYSIAYTADENGYQPQGAHLP 95
            :|..||..|.:.|.|||||:|.||.|||
  Fly    77 WVGPDGIHYKLNYLADENGFQAQGEHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 24/54 (44%)
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:278791 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.