DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:80 Identity:28/80 - (35%)
Similarity:46/80 - (57%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEALNVK-GTYSFVADDGQTYSIAYTADEN 85
            |::||.|  |:...|||.:....:..|.||:..|:...:.|: |.||:.:.:|...::.||||||
  Fly    58 KEQSDDG--SYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADEN 120

  Fly    86 GYQPQGAHLPVAPVV 100
            |::..|.|:|..|.:
  Fly   121 GFRATGDHIPTPPAI 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 18/55 (33%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 18/55 (33%)

Return to query results.
Submit another query.