DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr49Af

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:104 Identity:49/104 - (47%)
Similarity:65/104 - (62%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIVFVALFALAVA---DVQILKQESDV---GPVSFNYGYETSDGSSAQAAGQLKNVGTDEEA 59
            ||:|:: :|||.:|.:   :...:.|||:|   |  .::|.||..|||.|...|.||:|..|...
  Fly     1 MKYLML-IALFVVAASATDNDDPISQESNVEYNG--KYHYHYELKDGSKATQDGVLKSVNADHNG 62

  Fly    60 LNVKGTYSFVADDGQTYSIAYTADENGYQPQGAHLPVAP 98
            .:|.|.||||||||:||.::||||||||...|.|||..|
  Fly    63 ESVNGKYSFVADDGKTYVVSYTADENGYLAVGDHLPTPP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 30/54 (56%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 30/54 (56%)

Return to query results.
Submit another query.