DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Cpr49Ac

DIOPT Version :9

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster


Alignment Length:80 Identity:21/80 - (26%)
Similarity:40/80 - (50%) Gaps:10/80 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QILKQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEALNVKGTYSFVADDGQTYSIAYTAD 83
            ::.||:      .:::.|.|.:|...:...:|.:.|    ..:.||.|.:..|||:.|.:.|.::
  Fly   168 EVRKQD------KYDHSYLTENGIYGEEQAKLHHTG----GTHAKGFYEYTGDDGKLYRVNYASN 222

  Fly    84 ENGYQPQGAHLPVAP 98
            :.|:.|||.|:...|
  Fly   223 DGGFMPQGDHIHPIP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:278791 13/54 (24%)
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.