powered by:
Protein Alignment Lcp65Af and Cpr47Ee
DIOPT Version :9
Sequence 1: | NP_477274.1 |
Gene: | Lcp65Af / 45017 |
FlyBaseID: | FBgn0020639 |
Length: | 100 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610659.1 |
Gene: | Cpr47Ee / 36193 |
FlyBaseID: | FBgn0033602 |
Length: | 369 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 30/70 - (42%) |
Similarity: | 50/70 - (71%) |
Gaps: | 2/70 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 SFNYGYETSDGSSAQAAGQLKNVGTDE--EALNVKGTYSFVADDGQTYSIAYTADENGYQPQGAH 93
||:|||.::||::|||.|.:||:|..| ||..::|:||:.:.:|...::.|.|||||::.:|..
Fly 119 SFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRYIADENGFRAEGTG 183
Fly 94 LPVAP 98
:|.:|
Fly 184 IPSSP 188
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2EQ63 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1459720at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.920 |
|
Return to query results.
Submit another query.