DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lcp65Af and Lcp4

DIOPT Version :10

Sequence 1:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_476622.1 Gene:Lcp4 / 35820 FlyBaseID:FBgn0002535 Length:112 Species:Drosophila melanogaster


Alignment Length:101 Identity:33/101 - (32%)
Similarity:51/101 - (50%) Gaps:11/101 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFLIVFVALFALAVA--DVQILKQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEALNVKG 64
            |.|:| .||.||..|  :.::.:..:||....|.......:||:|.|.|.:..        |:.|
  Fly     3 KILLV-CALVALVAANENPEVKELVNDVQADGFVSKLVLDNGSAASATGDVHG--------NIDG 58

  Fly    65 TYSFVADDGQTYSIAYTADENGYQPQGAHLPVAPVV 100
            .:.:|:.:|:...::|.|||||||||...||..|.:
  Fly    59 VFEWVSPEGEHVRVSYKADENGYQPQSDLLPTPPPI 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 15/54 (28%)
Lcp4NP_476622.1 Chitin_bind_4 40..81 CDD:459790 14/48 (29%)

Return to query results.
Submit another query.